PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1471s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 344aa    MW: 38316.2 Da    PI: 8.7012
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1471s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.2e-52141391128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+v+yL++kv+g++++l ++i e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg
  SapurV1A.1471s0010.1.p  14 LPPGFRFHPTDEELLVQYLCRKVAGHHFSL-QIIGEIDLYKFDPWLLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATG 99 
                             79***************************9.89***************7777799******************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  SapurV1A.1471s0010.1.p 100 TDKVITT-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                             *****99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-679162IPR003441NAC domain
PROSITE profilePS5100560.50314162IPR003441NAC domain
PfamPF023658.2E-2715139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGLQETDPLS QLSLPPGFRF HPTDEELLVQ YLCRKVAGHH FSLQIIGEID LYKFDPWLLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLI ESSRKNGSTK LDEWVLCRIY KKKSGAAQKS MPGASSKEPS  180
TNSSSSSFSS HLDDDVLDPL PEMDGRFLDL PRANSLKPMQ HEEKINLANL GSGSFDWATL  240
AGLNSVPQLV QTQPGVSYSN SNVNDVYVPS MSQLCHMDSS AERMGNSVEE EVQSGVRTRL  300
ESAGNPGFFQ QNSSVMPPNF PNSLDPYWLR YSIQPGSGFG FKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-11011687174NAC domain-containing protein 19
3swm_B1e-11011687174NAC domain-containing protein 19
3swm_C1e-11011687174NAC domain-containing protein 19
3swm_D1e-11011687174NAC domain-containing protein 19
3swp_A1e-11011687174NAC domain-containing protein 19
3swp_B1e-11011687174NAC domain-containing protein 19
3swp_C1e-11011687174NAC domain-containing protein 19
3swp_D1e-11011687174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370304.10.0no apical meristem family protein
SwissprotQ93VY31e-127NAC72_ARATH; NAC domain-containing protein 72
TrEMBLB9N1K90.0B9N1K9_POPTR; No apical meristem family protein
STRINGPOPTR_0001s41460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-124NAC family protein